Serotype M6 50S Ribosomal Protein L7/L12, Recombinant, Streptococcus pyogenes, aa1-121, His-SUMO-Tag, Myc-Tag (rplL)
Catalog No : USB-406038
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Serotype M6 50S Ribosomal Protein L7/L12, Recombinant, Streptococcus pyogenes, aa1-121, His-SUMO-Tag, Myc-Tag (rplL) | ||
|---|---|---|---|
| Catalog No | USB-406038 | ||
| Supplier’s Catalog No | 406038 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 32.3 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation. Source: Recombinant protein corresponding to aa1-121 from Streptococcus pyogenes Serotype M6 50S ribosomal protein L7/L12, fused to His-SUMO-Tag at N-terminal and fused to Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~32.3kD AA Sequence: MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAAAAAGGAEEAAKDSFDVELTSAGDKKVGVIKAVREITGLGLKEAKGLVDGAPANVKEGVAAAEAEEIKAKLEEAGATITLK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved