Viral interleukin-10 Homolog, Recombinant, Human Cytomegalovirus, aa26-176 (UL111A)
Catalog No : USB-406063
565.53€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Viral interleukin-10 Homolog, Recombinant, Human Cytomegalovirus, aa26-176 (UL111A) | ||
---|---|---|---|
Catalog No | USB-406063 | ||
Supplier’s Catalog No | 406063 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, E. coli | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 17.5 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Purified | ||
Purity | ~90% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~90% (SDS-PAGE) | ||
Description | Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells. Source: Recombinant protein corresponding to aa26-176 from human Cytomegalovirus Viral interleukin-10 Homolog, expressed in E. coli. Molecular Weight: ~17.5kD AA Sequence: ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved