Hepatitis A Virus Cellular Receptor 2 Homolog, Recombinant, Mouse, aa20-191, Fc-Tag (Havcr2)
Catalog No : USB-516807
393.11€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Hepatitis A Virus Cellular Receptor 2 Homolog, Recombinant, Mouse, aa20-191, Fc-Tag (Havcr2) | ||
---|---|---|---|
Catalog No | USB-516807 | ||
Supplier’s Catalog No | 516807 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, Mammalian cell | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 46.3 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Purified | ||
Purity | ≥90% (SDS-PAGE) | ||
Form | Supplied as a lyophilized powder in PBS, pH 7.4. | ||
Reactivity life | |||
Note | For reserch purpose only | ||
Purity | ≥90% (SDS-PAGE) | ||
Description | Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand. Source: Recombinant partial protein corresponding to aa20-191 of mouse Hepatitis A Virus Cellular Receptor 2 Homolog, fused to Fc-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~46.3kD Biological Activity: The ED50 as determined by its ability to bind human Galectin 9 in functional ELISA is less than 20ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved