Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Hepatitis A Virus Cellular Receptor 2 Homolog, Recombinant, Mouse, aa20-191, Fc-Tag (Havcr2)
Catalog No			USB-516807
Supplier’s Catalog No			516807
Supplier			US Biologicals
Source antigen			Recombinant, Mammalian cell
Reactivity
Cross reactivity
Applications
Molecular weight			46.3

Storage			-20°C
Other names
Grade			Purified
Purity			≥90% (SDS-PAGE)
Form			Supplied as a lyophilized powder in PBS, pH 7.4.
Reactivity life
Note			For reserch purpose only
Purity			≥90% (SDS-PAGE)
Description			Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand. Source: Recombinant partial protein corresponding to aa20-191 of mouse Hepatitis A Virus Cellular Receptor 2 Homolog, fused to Fc-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~46.3kD Biological Activity: The ED50 as determined by its ability to bind human Galectin 9 in functional ELISA is less than 20ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.