Cyanovirin-N, Recombinant, Nostoc Ellipsosporum, aa1-101, His-Tag
Catalog No : USB-517856
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Cyanovirin-N, Recombinant, Nostoc Ellipsosporum, aa1-101, His-Tag | ||
|---|---|---|---|
| Catalog No | USB-517856 | ||
| Supplier’s Catalog No | 517856 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 15 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. | ||
| Reactivity life | |||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Its activity in situ is unknown, however it acts as a viral entry inhibitor, inhibiting HIV-1, HIV-2 and simian immunodeficiency virus (and some other viruses such as feline immunodeficiency virus, measles virus and human herpesvirus) infection and replication. It prevents essential interactions between the envelope glycoprotein and target cell receptors by binding to carbohydrates on viral protein gp120 and possibly by other mechanisms as well. Addition to cells must occur before or shortly after virus addition. It also inhibits cell-to-cell fusion, and virus-to-cell and cell-to-cell transmission of a viral infection. Is remarkably stabile; the protein can withstand multiple freeze-thaw cycles, dissolution in organic solvents, treatment with salt, detergent, H2O2 and boiling without significant loss of anti-HIV activity. Source: Recombinant protein corresponding to aa1-101 of Nostoc Ellipsosporum Cyanovirin-N, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~15kD AA Sequence: LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved