Cytomegalovirus Uncharacterized Protein UL128, Recombinant, Human, aa1-171, His-Tag (UL128)
Catalog No : USB-517862
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Cytomegalovirus Uncharacterized Protein UL128, Recombinant, Human, aa1-171, His-Tag (UL128) | ||
|---|---|---|---|
| Catalog No | USB-517862 | ||
| Supplier’s Catalog No | 517862 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 23.7 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. | ||
| Reactivity life | |||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Source: Recombinant full length protein corresponding to aa1-171 of human Cytomegalovirus Uncharacterized Protein UL128, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.7kD AA Sequence: MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved