Enterotoxin Type B, Recombinant, Staphylococcus Aureus, aa28-266, GST-Tag (entB)

Catalog No : USB-517893
506.91€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Enterotoxin Type B, Recombinant, Staphylococcus Aureus, aa28-266, GST-Tag (entB)
Catalog No USB-517893
Supplier’s Catalog No 517893
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 55.4
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Source: Recombinant protein corresponding to aa28-266 of Staphylococcus Aureus Enterotoxin Type B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~55.4kD AA Sequence: ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.