Heat-labile Enterotoxin A Chain, Recombinant, E. coli, aa19-258, His-Tag, Myc-Tag (eltA)
Catalog No : USB-517946
471.28€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Heat-labile Enterotoxin A Chain, Recombinant, E. coli, aa19-258, His-Tag, Myc-Tag (eltA) | ||
---|---|---|---|
Catalog No | USB-517946 | ||
Supplier’s Catalog No | 517946 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, E. coli | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 32.8 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Purified | ||
Purity | ~85% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. | ||
Reactivity life | |||
Note | For reserch purpose only | ||
Purity | ~85% (SDS-PAGE) | ||
Description | The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase. Source: Recombinant protein corresponding to aa19-258 of E. coli Heat-labile Enterotoxin A Chain, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~32.8kD AA Sequence: NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved