Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Influenza B Virus Non-Structural Protein 1 (NS), Recombinant, aa1-281, His-Tag (NS)
Catalog No			USB-517962
Supplier’s Catalog No			517962
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			36.1

Storage			-20°C
Other names
Grade			Purified
Purity			~85% (SDS-PAGE)
Form			Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note			For reserch purpose only
Purity			~85% (SDS-PAGE)
Description			Binds and inhibits the conjugation of the ubiquitin-like G1P2/ISG15 protein to its target proteins. Since G1P2/ISG15 is an early antiviral protein, NS1 may inhibit the host antiviral response. Prevents EIF2AK2/PKR activation, either by binding double strand RNA or by interacting directly with EIF2AK2/PKR. Also binds poly(A) and U6 snRNA. Source: Recombinant protein corresponding to aa1-281 of Influenza B virus (strain B/Lee/1940) Non-Structural Protein 1, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.1kD AA Sequence: MADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPYCVKNPSTSKCPNYDWTDYPPTPGKYLDDIEEEPENVDHPIEVVLRDMNNKDARQKIKDEVNTQKEGKFRLTIKRDIRNVLSLRVLVNGTFLKHPNGDKSLSTLHRLNAYDQNGGLVAKLVATDDRTVEDEKDGHRILNSLFERFDEGHSKPIRAAETAVGVLSQFGQEHRLSPEEGDN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.