Major Outer Membrane Protein P.IB, Recombinant, Neisseria Meningitidis Serogroup B, aa20-331, His-Tag (porB)
Catalog No : USB-517995
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Major Outer Membrane Protein P.IB, Recombinant, Neisseria Meningitidis Serogroup B, aa20-331, His-Tag (porB) | ||
---|---|---|---|
Catalog No | USB-517995 | ||
Supplier’s Catalog No | 517995 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, E. coli | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 37.8 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Purified | ||
Purity | ~85% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. | ||
Reactivity life | |||
Note | For reserch purpose only | ||
Purity | ~85% (SDS-PAGE) | ||
Description | Serves as a slightly cation selective porin. Source: Recombinant protein corresponding to aa20-331 of Neisseria Meningitidis Serogroup B Major Outer Membrane Protein P.IB, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.8kD AA Sequence: DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved