Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Matrix Protein, Recombinant, Vesicular Stomatitis Indiana Virus, aa1-237, His-Tag (M)
Catalog No			USB-518000
Supplier’s Catalog No			518000
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			30.8

Storage			-20°C
Other names
Grade			Purified
Purity			~85% (SDS-PAGE)
Form			Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note			For reserch purpose only
Purity			~85% (SDS-PAGE)
Description			Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shut off presumably inhibit interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell. Source: Recombinant protein corresponding to aa1-237 of Vesicular Stomatitis Indiana Virus Matrix Protein (strain Glasgow), fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.8kD AA Sequence: MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.