Outer Capsid Glycoprotein VP7, Recombinant, Rotavirus A, aa34-309, His-Tag, Myc-Tag
Catalog No : USB-518033
471.28€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Outer Capsid Glycoprotein VP7, Recombinant, Rotavirus A, aa34-309, His-Tag, Myc-Tag | ||
|---|---|---|---|
| Catalog No | USB-518033 | ||
| Supplier’s Catalog No | 518033 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 36 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. | ||
| Reactivity life | |||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Outer capsid protein involved in attachment and possibly entry into the host epithelial cell. It is subsequently lost, together with VP4, following virus entry into the host cell. The outer layer contains 780 copies of VP7, grouped as 260 trimers. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. In integrin-dependent strains, VP7 seems to essentially target the integrin heterodimers ITGAX/ITGB2 and ITGA5/ITGB3 at a postbinding stage, once the initial attachment by VP4 has been achieved. Source: Recombinant protein corresponding to aa34-309 of Rotavirus A Outer Capsid Glycoprotein VP7, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~36kD AA Sequence: QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQIIQTMSKRSRSLNSSAFYYRV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved