RNA-Directed RNA Polymerase L, Recombinant, Zaire Ebolavirus, aa625-809, His-Tag (L)

Catalog No : USB-518095
506.91€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name RNA-Directed RNA Polymerase L, Recombinant, Zaire Ebolavirus, aa625-809, His-Tag (L)
Catalog No USB-518095
Supplier’s Catalog No 518095
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 24.9
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description RNA-directed RNA polymerase that catalyzes the transcription of viral mRNAs, their capping and polyadenylation. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The viral polymerase binds to the genomic RNA at the 3' leader promoter, and transcribes subsequently all viral mRNAs with a decreasing efficiency. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein acts as a processivity factor. Capping is concommitant with initiation of mRNA transcription. Indeed, a GDP polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both activities being carried by the viral polymerase. Polyadenylation of mRNAs occur by a stuttering mechanism at a slipery stop site present at the end viral genes. After finishing transcription of a mRNA, the polymerase can resume transcription of the downstream gene. RNA-directed RNA polymerase that catalyzes the replication of viral genomic RNA. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The replicase mode is dependent on intracellular N protein concentration. In this mode, the polymerase replicates the whole viral genome without recognizing transcriptional signals, and the replicated genome is not caped or poly. Source: Partial recombinant protein corresponding to aa625-809 of Zaire Ebolavirus (strain Mayinga-76) RNA-Directed RNA Polymerase L, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.9kD AA Sequence: RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.