Itgal, Recombinant, Mouse, aa153-325, His-Tag (Integrin alpha-L)

Catalog No : USB-373874
471.28€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Itgal, Recombinant, Mouse, aa153-325, His-Tag (Integrin alpha-L)
Catalog No USB-373874
Supplier’s Catalog No 373874
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 23.7
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Mice expressing a null mutation of the alpha-L subunit gene demonstrate impaired tumor rejection and impaired leukocytes recruitment. Source: Recombinant protein corresponding to aa153-325 from mouse Itgal, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.7kD AA Sequence: DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.