Itgal, Recombinant, Mouse, aa153-325, His-Tag (Integrin alpha-L)
Catalog No : USB-373875
471.28€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Itgal, Recombinant, Mouse, aa153-325, His-Tag (Integrin alpha-L) | ||
---|---|---|---|
Catalog No | USB-373875 | ||
Supplier’s Catalog No | 373875 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, Yeast | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 21.7 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Purified | ||
Purity | ~85% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~85% (SDS-PAGE) | ||
Description | Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Mice expressing a null mutation of the alpha-L subunit gene demonstrate impaired tumor rejection and impaired leukocytes recruitment. Source: Recombinant protein corresponding to aa153-325 from mouse Integrin alpha-L, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~21.7kD AA Sequence: DLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved