CACNA2D1, Recombinant, Human, aa528-668, His-SUMO-Tag (Voltage-dependent Calcium Channel Subunit alpha-2/delta-1)
Catalog No : USB-372533
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | CACNA2D1, Recombinant, Human, aa528-668, His-SUMO-Tag (Voltage-dependent Calcium Channel Subunit alpha-2/delta-1) | ||
---|---|---|---|
Catalog No | USB-372533 | ||
Supplier’s Catalog No | 372533 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, E. coli | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 32.3 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Purified | ||
Purity | ~85% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~85% (SDS-PAGE) | ||
Description | The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling. Source: Recombinant protein corresponding to aa528-668 from human CACNA2D1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.3kD AA Sequence: QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved