Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			CLIC4, Recombinant, Human, aa1-253, GST-Tag (Chloride Intracellular Channel Protein 4)
Catalog No			USB-372787
Supplier’s Catalog No			372787
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			55.8

Storage			-20°C
Other names
Grade			Purified
Purity			~90% (SDS-PAGE)
Form			Supplied as a liquid in Tris, 50% glycerol.
Reactivity life			6 months
Note			For reserch purpose only
Purity			~90% (SDS-PAGE)
Description			Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Promotes cell-surface expression of HRH3. Has alternate cellular functions like a potential role in angiogenesis or in maintaining apical-basolateral membrane polarity during mitosis and cytokinesis. Could also promote endothelial cell proliferation and regulate endothelial morphogenesis (tubulogenesis). Source: Recombinant protein corresponding to aa1-253 from human CLIC4, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~55.8kD AA Sequence: MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.