GRIN2A, Recombinant, Human, His-Tag, aa501-550, aa601-630, aa701-750 (Glutamate [NMDA] Receptor Subunit epsilon-1)
Catalog No : USB-373530
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | GRIN2A, Recombinant, Human, His-Tag, aa501-550, aa601-630, aa701-750 (Glutamate [NMDA] Receptor Subunit epsilon-1) | ||
|---|---|---|---|
| Catalog No | USB-373530 | ||
| Supplier’s Catalog No | 373530 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 18.2 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Activation requires binding of agonist to both types of subunits. Source: Partial recombinant protein corresponding to aa501-550, aa601-630, aa701-750 from human GRIN2A, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.2kD AA Sequence: VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved