KCNJ10, Recombinant, Human, aa165-379, His-SUMO-Tag (ATP-sensitive Inward Rectifier Potassium Channel 10)
Catalog No : USB-373906
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | KCNJ10, Recombinant, Human, aa165-379, His-SUMO-Tag (ATP-sensitive Inward Rectifier Potassium Channel 10) | ||
---|---|---|---|
Catalog No | USB-373906 | ||
Supplier’s Catalog No | 373906 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, E. coli | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 39.8 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Highly Purified | ||
Purity | ~90% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~90% (SDS-PAGE) | ||
Description | May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of Extracellular domain potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by Extracellular domain barium and cesium. Source: Recombinant protein corresponding to aa165-379 from human KCNJ10, fuaed to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.8kD AA Sequence: FLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved