SLC1A2, Recombinant, Mouse, aa143-238, GST-Tag (Excitatory Amino Acid Transporter 2)

Catalog No : USB-375312
471.28€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name SLC1A2, Recombinant, Mouse, aa143-238, GST-Tag (Excitatory Amino Acid Transporter 2)
Catalog No USB-375312
Supplier’s Catalog No 375312
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 34.6
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium. Source: Recombinant protein corresponding to aa143-238 from mouse Slc1a2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.6kD AA Sequence: HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.