SLC27A2, Recombinant, Human, aa283-620, His-Tag (Very Long-Chain acyl-CoA Synthetase)
Catalog No : USB-375320
445.99€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | SLC27A2, Recombinant, Human, aa283-620, His-Tag (Very Long-Chain acyl-CoA Synthetase) | ||
---|---|---|---|
Catalog No | USB-375320 | ||
Supplier’s Catalog No | 375320 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, Yeast | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 40.8 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Highly Purified | ||
Purity | ~90% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~90% (SDS-PAGE) | ||
Description | Acyl-CoA synthetase probably involved in bile acid metabolism. Proposed to activate C27 precurors of bile acids to their CoA thioesters derivatives before side chain cleavage via peroxisomal beta-oxidation occurs. In vitro, activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Does not utilize C24 bile acids as substrates. In vitro, also activates long- and branched-chain fatty acids and may have additional roles in fatty acid metabolism. May be involved in translocation of long-chain fatty acids (LFCA) across membranes. Source: Recombinant protein corresponding to aa283-620 from human SLC27A2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~40.8kD AA Sequence: GATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved