SLC34A2, Recombinant, Human, aa574-689, His-Tag (Sodium-dependent Phosphate Transport Protein 2B)
Catalog No : USB-375321
445.99€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | SLC34A2, Recombinant, Human, aa574-689, His-Tag (Sodium-dependent Phosphate Transport Protein 2B) | ||
---|---|---|---|
Catalog No | USB-375321 | ||
Supplier’s Catalog No | 375321 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, Yeast | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 15.1 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Highly Purified | ||
Purity | ~90% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~90% (SDS-PAGE) | ||
Description | May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli. Source: Recombinant protein corresponding to aa574-689 from human SLC34A2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.1kD AA Sequence: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved