Voltage-Dependent Calcium Channel Subunit Alpha-2/Delta-1, Recombinant, Human, aa577-717, His-Sumo-Tag (CACNA2D1)
Catalog No : USB-518155
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Voltage-Dependent Calcium Channel Subunit Alpha-2/Delta-1, Recombinant, Human, aa577-717, His-Sumo-Tag (CACNA2D1) | ||
|---|---|---|---|
| Catalog No | USB-518155 | ||
| Supplier’s Catalog No | 518155 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 32.3 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. | ||
| Reactivity life | |||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling. Source: Recombinant protein corresponding to aa577-717 of human Voltage-Dependent Calcium Channel Subunit Alpha-2/Delta-1, fused to 6xHis-Sumo-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.3kD AA Sequence: KMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPNNPSCNADLINRVLLDAGFTNELVQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved