Klk1b22, Recombinant, Mouse, aa25-259, His-SUMO-Tag (Kallikrein 1-related Peptidase b22)
Catalog No : USB-373932
471.28€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Klk1b22, Recombinant, Mouse, aa25-259, His-SUMO-Tag (Kallikrein 1-related Peptidase b22) | ||
---|---|---|---|
Catalog No | USB-373932 | ||
Supplier’s Catalog No | 373932 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, E. coli | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 41.8 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Highly Purified | ||
Purity | ~90% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~90% (SDS-PAGE) | ||
Description | Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Source: Recombinant protein corresponding to aa25-259 from mouse Klk1b22, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.8kD AA Sequence: ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved