Klk8, Recombinant, Mouse, aa33-260, His-Tag (Kallikrein-8)
Catalog No : USB-373936
471.28€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Klk8, Recombinant, Mouse, aa33-260, His-Tag (Kallikrein-8) | ||
---|---|---|---|
Catalog No | USB-373936 | ||
Supplier’s Catalog No | 373936 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, Yeast | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 27.1 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Purified | ||
Purity | ~90% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~90% (SDS-PAGE) | ||
Description | Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury. Source: Recombinant protein corresponding to aa33-260 from mouse Klk8, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.1kD AA Sequence: ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved