Keratin 7 (KRT7) Recombinant, Rat

Catalog No : USB-155535
405.76€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Keratin 7 (KRT7) Recombinant, Rat
Catalog No USB-155535
Supplier’s Catalog No 155535
Supplier US Biologicals
Source antigen Recombinant Rat from E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 21.5
Storage 4°C/-70°C
Other names
Grade Highly Purified
Purity ≥95%
Form Supplied as lyophilized powder in PBS, pH7.4, 5% sucrose, 0.01% sarcosyl. Reconstitute in sterile PBS, pH7.2.
Reactivity life 12 months
Note For reserch purpose only
Purity ≥95%
Description Source: Recombinant Rat from E. coli Purity: ≥95% Endotoxin: 1.0EU per 1ug (determined by the LAL method) Accession No: Q6IG12 Fragment: Ile255~Glu393 (Accession No: Q6IG12) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-IADVKA QYEEMANHSR AEAEAWYQTK FETLQAQAGK HGDDLRNTRN EIAEMNRSIQ RLQAEIDTLK NQRAKLESSI AEAEEQGELA IKDAHAKQGE LEAALQKAKQ DVARQLREYQ ELLNTKLALD IEIATYRKLL EGE Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 21.5kD Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.