Keratin 8 (KRT8) Recombinant, Rat
Catalog No : USB-155538
419.55€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Keratin 8 (KRT8) Recombinant, Rat | ||
---|---|---|---|
Catalog No | USB-155538 | ||
Supplier’s Catalog No | 155538 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant Rat from E. coli | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 21.6 |
Storage | 4°C/-70°C | ||
---|---|---|---|
Other names | |||
Grade | Highly Purified | ||
Purity | ≥95% | ||
Form | Supplied as lyophilized powder in PBS, pH7.4, 5% sucrose, 0.01% sarcosyl. Reconstitute in sterile PBS, pH7.2. | ||
Reactivity life | 12 months | ||
Note | For reserch purpose only | ||
Purity | ≥95% | ||
Description | Source: Recombinant Rat from E. coli Purity: ≥95% Endotoxin: 1.0EU per 1ug (determined by the LAL method) Accession No: Q10758 Fragment: Ile260~Glu398 (Accession No: Q10758) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-I AEVRAQYEEI ANRSRAEAET MYQIKYEELQ TLAGKHGDDL RRSKTEISEM NRNISRLQAE IDALKGQRAT LEAAIADAEQ RGELAVKDAN AKLEDLKNAL QKAKQDMARQ LREYQELMNV KLALDIEIAT YRKLLEGE Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 21.6kD Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions. |
© 2020 Imugex All Rights Reserved