Ferritin-2, Chloroplastic, Recombinant, Glycine Max, aa52-257, His-SUMO-Tag (SFerH-2)
Catalog No : USB-370611
578.18€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Ferritin-2, Chloroplastic, Recombinant, Glycine Max, aa52-257, His-SUMO-Tag (SFerH-2) | ||
---|---|---|---|
Catalog No | USB-370611 | ||
Supplier’s Catalog No | 370611 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, E. coli | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 39.53 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Purified | ||
Purity | ~85% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Purity | ~85% (SDS-PAGE) | ||
Description | Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Source: Recombinant protein corresponding to aa52-257 from Glycine max Ferritin-2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.53kD AA Sequence: APAPLAGVIFEPFQELKKDYLAVPIAHNVXLARQNYADDSESAINEQINVEYNVSYVYHALFAYFDRDNIALKGLAKFFKESSEEEREHAEQLIKYQNIRGGRVVLHPITSPPSEFEHSEKGDALYAMELALSLEKLTNEKLLHVHSVAERNNDPQXADFIESEFLYEQVKSIKKIAEYVAQLRLVGKGHGVWHFDQKLLHDEDHV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved