Ferritin-2, Chloroplastic, Recombinant, Glycine Max, aa52-257, His-SUMO-Tag (SFerH-2)

Catalog No : USB-370611
578.18€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Ferritin-2, Chloroplastic, Recombinant, Glycine Max, aa52-257, His-SUMO-Tag (SFerH-2)
Catalog No USB-370611
Supplier’s Catalog No 370611
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 39.53
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Source: Recombinant protein corresponding to aa52-257 from Glycine max Ferritin-2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.53kD AA Sequence: APAPLAGVIFEPFQELKKDYLAVPIAHNVXLARQNYADDSESAINEQINVEYNVSYVYHALFAYFDRDNIALKGLAKFFKESSEEEREHAEQLIKYQNIRGGRVVLHPITSPPSEFEHSEKGDALYAMELALSLEKLTNEKLLHVHSVAERNNDPQXADFIESEFLYEQVKSIKKIAEYVAQLRLVGKGHGVWHFDQKLLHDEDHV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.