TIMP3, Recombinant, Human, aa30-208, His-Tag (Metalloproteinase inhibitor 3)

Catalog No : USB-370813
468.98€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name TIMP3, Recombinant, Human, aa30-208, His-Tag (Metalloproteinase inhibitor 3)
Catalog No USB-370813
Supplier’s Catalog No 370813
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 24.9
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to rodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15. Source: Recombinant protein corresponding to aa30-208 from human TIMP3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.9kD AA Sequence: HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.