Mmp7, Recombinant, Rat, aa98-267, GST-Tag (Matrilysin)

Catalog No : USB-374242
471.28€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Mmp7, Recombinant, Rat, aa98-267, GST-Tag (Matrilysin)
Catalog No USB-374242
Supplier’s Catalog No 374242
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 45.9
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase. Source: Recombinant protein corresponding to aa98-267 from rat Mmp7, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.9kD AA Sequence: FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.