MT1F, Recombinant, Human, aa1-59, His-Tag (Metallothionein-1F)
Catalog No : USB-374295
445.99€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | MT1F, Recombinant, Human, aa1-59, His-Tag (Metallothionein-1F) | ||
|---|---|---|---|
| Catalog No | USB-374295 | ||
| Supplier’s Catalog No | 374295 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 7.9 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. Source: Partial recombinant protein corresponding to aa1-59 from human Metallothionein-1F, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~7.9kD AA Sequence: MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved