PEDV, Recombinant, His-Tag (CV777) (Envelope small membrane protein(E), Porcine epidemic diarrhea virus)
Catalog No : USB-168619
1124.17€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | PEDV, Recombinant, His-Tag (CV777) (Envelope small membrane protein(E), Porcine epidemic diarrhea virus) | ||
|---|---|---|---|
| Catalog No | USB-168619 | ||
| Supplier’s Catalog No | 168619 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 10 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris buffer, pH 8.0, 50% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Component of the viral envelope that plays a central role in virus morphogenesis and assembly. It is sufficient to form virus-like particles. Seems to be important for creating the membrane curvature needed to acquire the rounded, stable and infectious particle phenotype. Acts as a viroporin, inducing the formation of hydrophilic pores in cellular membranes. Also induces apoptosis Source: Full length recombinant protein corresponding to aa1-76 from PEDV, fused to His-tag derived from yeast. Molecular Weight: ~10kD AA Sequence: MLQLVNDNGLVVNVILWLFVLFFLLIISITFVQLVNLCFTCHRLCNSAVYTPIGRLYRVYKSYMRIDPLPSTVIDV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved