Outer Membrane Protein C, Recombinant, Escherichia coli, aa22-367, His-SUMO-Tag (OmpC)

Catalog No : USB-370730
506.91€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Outer Membrane Protein C, Recombinant, Escherichia coli, aa22-367, His-SUMO-Tag (OmpC)
Catalog No USB-370730
Supplier’s Catalog No 370730
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 54.28
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Forms pores that allow passive diffusion of small molecules across the outer membrane. Source: Recombinant protein corresponding to aa22-367 from Escherichia coli ompC, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~54.28kD AA Sequence: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.