BamA, Recombinant, Klebsiella Pneumoniae, aa24-172, His-GST-Tag/Myc-Tag (Outer Membrane Protein Assembly Factor)
Catalog No : USB-372406
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | BamA, Recombinant, Klebsiella Pneumoniae, aa24-172, His-GST-Tag/Myc-Tag (Outer Membrane Protein Assembly Factor) | ||
|---|---|---|---|
| Catalog No | USB-372406 | ||
| Supplier’s Catalog No | 372406 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 33.3 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery. Source: Recombinant protein corresponding to aa24-172 from klebsiella pneumoniae BamA, fused to His-GST-Tag at N-terminal and Myc-Tag at C-terminal expressed in E.coli. Molecular Weight: ~33.3kD AA Sequence: FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved