Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Renin Receptor, Recombinant, Human, aa17-302, His-SUMO-Tag (ATP6AP2)
Catalog No			USB-375036
Supplier’s Catalog No			375036
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			53.5

Storage			-20°C
Other names
Grade			Purified
Purity			~90% (SDS-PAGE)
Form			Supplied as a liquid in Tris, 50% glycerol.
Reactivity life			6 months
Note			For reserch purpose only
Purity			~90% (SDS-PAGE)
Description			This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases. Source: Recombinant protein corresponding to aa17-302 from human Renin Receptor, fused to His-SUMO-Tag, expressed in E. coli. Molecular Weight: ~53.5kD AA Sequence: NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.