SLAM Family Member 7, Recombinant, Mouse, aa23-224, His-Tag (Slamf7)

Catalog No : USB-518115
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name SLAM Family Member 7, Recombinant, Mouse, aa23-224, His-Tag (Slamf7)
Catalog No USB-518115
Supplier’s Catalog No 518115
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 27.8
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on the adapter SH2D1B. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells. May play a role in lymphocyte adhesion. In LPS-activated monocytes negatively regulates production of proinflammatory cytokines. Source: Recombinant protein corresponding to aa23-224 of mouse SLAM Family Member 7, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.8kD AA Sequence: SGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSLRG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.