HLA-C, Recombinant, Human, aa25-308, His-Tag (HLA-C Protein, MHC Class I Antigen)

Catalog No : USB-373640
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name HLA-C, Recombinant, Human, aa25-308, His-Tag (HLA-C Protein, MHC Class I Antigen)
Catalog No USB-373640
Supplier’s Catalog No 373640
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 36.7
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Involved in the presentation of foreign antigens to the immune system. SAAS annotation. Partial recombinant protein corresponding to aa25-308 from human HLA-C, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.7kD AA Sequence: CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.