SCO2, Recombinant, Human, aa43-226, His-SUMO-Tag (SCO2 Homolog, Mitochondrial)

Catalog No : USB-375223
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name SCO2, Recombinant, Human, aa43-226, His-SUMO-Tag (SCO2 Homolog, Mitochondrial)
Catalog No USB-375223
Supplier’s Catalog No 375223
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 41.1
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Acts as a copper chaperone, transporting copper to the Cu(A) site on the cytochrome c oxidase subunit II (COX2). Source: Recombinant protein corresponding to aa43-266 from human SCO2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.1kD AA Sequence: PAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.