SMCP, Recombinant, Human, aa1-116, GST-Tag (Sperm Mitochondrial-associated Cysteine-rich Protein)
Catalog No : USB-375338
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | SMCP, Recombinant, Human, aa1-116, GST-Tag (Sperm Mitochondrial-associated Cysteine-rich Protein) | ||
|---|---|---|---|
| Catalog No | USB-375338 | ||
| Supplier’s Catalog No | 375338 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 39.8 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the fale reproductive tract and inability to penetrate the oocyte zona pellucida. Source: Recombinant protein corresponding to aa1-116 from human SMCP, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.8kD AA Sequence: MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved