ABCB1, Recombinant, Human, aa236-297, His-Tag (Multidrug Resistance Protein 1)

Catalog No : USB-372104
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name ABCB1, Recombinant, Human, aa236-297, His-Tag (Multidrug Resistance Protein 1)
Catalog No USB-372104
Supplier’s Catalog No 372104
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 10.8
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells. Source: Recombinant protein corresponding to aa236-297 from human ABCB1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~10.8kD AA Sequence: LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.