MDR1, Recombinant, Entamoeba Histolytica, aa1-114, His-Tag (Multidrug Resistance Protein 1)

Catalog No : USB-374181
527.60€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name MDR1, Recombinant, Entamoeba Histolytica, aa1-114, His-Tag (Multidrug Resistance Protein 1)
Catalog No USB-374181
Supplier’s Catalog No 374181
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 14.49
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells. Source: Recombinant protein corresponding to aa1-114 from entamoeba histolytica MDR1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.49kD AA Sequence: SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.