MYEF2, Recombinant, Human, aa372-576, His-SUMO-Tag (Myelin Expression Factor 2)

Catalog No : USB-374341
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name MYEF2, Recombinant, Human, aa372-576, His-SUMO-Tag (Myelin Expression Factor 2)
Catalog No USB-374341
Supplier’s Catalog No 374341
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 37.3
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA. Source: Recombinant protein corresponding to aa372-576 from human MYEF2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.3kD AA Sequence: GGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINQGFGDSFGRLGSAMIGGFAGRIGSSNMGPVGSGISGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.