PLP, Recombinant, Oncorhynchus Mykiss, aa150-218, His-Tag (Myelin Proteolipid Protein)
Catalog No : USB-374752
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | PLP, Recombinant, Oncorhynchus Mykiss, aa150-218, His-Tag (Myelin Proteolipid Protein) | ||
|---|---|---|---|
| Catalog No | USB-374752 | ||
| Supplier’s Catalog No | 374752 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 11.7 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation. Source: Recombinant protein corresponding to aa150-218 from oncorhynchus mykiss PLP, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.7kD AA Sequence: PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved