GMFB, Recombinant, Human (Glia Maturation Factor beta, GMF-beta)
Catalog No : USB-G2035-65E
474.73€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | GMFB, Recombinant, Human (Glia Maturation Factor beta, GMF-beta) | ||
|---|---|---|---|
| Catalog No | USB-G2035-65E | ||
| Supplier’s Catalog No | G2035-65E | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 17 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~98% (SDS-PAGE, HPLC) | ||
| Form | Supplied as a lyophilized powder from 20mM PBS, pH 7.4, 130mM sodium chloride. Reconstitute with sterile dH2O to ≥100ug/ml. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~98% (SDS-PAGE, HPLC) | ||
| Description | Glia Maturation Factor-Beta (GMF-Beta) is a 17kD protein nerve growth factor identified as a growth and differentiation factor in the vertebrate brain. Glia Maturation Factor-Beta stimulates differentiation of normal neurons as well as glial cells. GMFB inhibits the proliferation of the N-18 neuroblastoma line and the C6 glioma line while promoting their phenotypic expression. GMF-beta enhances the phenotypic expression of glia & neurons thus inhibits the proliferation of their respective tumors when added to cell culture. Cell- surface GMF-Beta acts on the target cells at close range when cells are in direct contact. GMF-Beta is produced by thymic epithelial cells and plays an important role in T cell development in favor of CD4+ T cells. Source: Recombinant corresponding to human GMF-Beta expressed in E. coli. AA Sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH Molecular Weight: ~17kD Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved