Glia Maturation Factor beta, Recombinant, Human (GMFB, GMF-beta)
Catalog No : USB-360312
477.02€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Glia Maturation Factor beta, Recombinant, Human (GMFB, GMF-beta) | ||
|---|---|---|---|
| Catalog No | USB-360312 | ||
| Supplier’s Catalog No | 360312 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 16.5 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~98% (SDS-PAGE, HPLC) | ||
| Form | Supplied as a lyophilized powder in 20mM PB, pH 7, 139mM sodium chloride. Reconstitute with sterile dH2O, 0.1% BSA to 0.1-1mg/ml. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~98% (SDS-PAGE, HPLC) | ||
| Description | GMFB, also known as GMF, belongs to the GMF subfamily of the larger actin-binding protein ADF family. This protein, which is phosphorylated following phorbol ester stimulation, is important for the nervous system. It causes brain cell differentiation, stimulates neural regeneration and inhibits tumor cell proliferation. Overexpression of GMFB in astrocytes has been shown to enhance brain-derived neurotrohic factor (BDNF) production. GMFB expression is increased by exercise, and the protein is crucial for exercise-induction of BDNF. Source: Recombinant protein corresponding to human Glia Maturation Factor beta, a single non-glycosylated polypeptide chain containing 141aa, expressed in E. coli. Molecular Weight: ~16.5kD (141aa) Applications: Suitable for use in SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Endotoxin: <1EU/mg (LAL) AA Sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNT EDLTEEWLREKLGFFH Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved