Synapsin-1, Recombinant, Human, aa113-420, GST-Tag (SYN1)
Catalog No : USB-370805
468.98€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Synapsin-1, Recombinant, Human, aa113-420, GST-Tag (SYN1) | ||
|---|---|---|---|
| Catalog No | USB-370805 | ||
| Supplier’s Catalog No | 370805 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 62 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level. Source: Recombinant protein corresponding to aa113-420 from human SYN1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~62kD AA Sequence: SRVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved