OCM, Recombinant, Mouse, aa2-109, His-Tag (Oncomodulin)

Catalog No : USB-374526
497.72€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name OCM, Recombinant, Mouse, aa2-109, His-Tag (Oncomodulin)
Catalog No USB-374526
Supplier’s Catalog No 374526
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 14.1
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. Source: Recombinant protein corresponding to aa2-109 from mouse Oncomodulin, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.1kD AA Sequence: SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.