SYNGR1, Recombinant, Human, aa1-191, GST-Tag (Synaptogyrin-1)

Catalog No : USB-375477
471.28€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name SYNGR1, Recombinant, Human, aa1-191, GST-Tag (Synaptogyrin-1)
Catalog No USB-375477
Supplier’s Catalog No 375477
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight
Storage -20°C
Other names
Grade
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Involved in the regulation of short-term and long-term synaptic plasticity. Source: Recombinant protein corresponding to aa1-191 from human SYNGR1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: 48.0kD AA Sequence: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.