Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Neurotrophin-4, Recombinant, Human (NT-4)
Catalog No			USB-360865
Supplier’s Catalog No			360865
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			28

Storage			-20°C
Other names
Grade			Highly Purified
Purity			~97% (SDS-PAGE, HPLC)
Form			Supplied as a lyophilized powder in 20mM PB, pH 7.4, 150mM sodium chloride. Reconstitute with sterile dH2O, 0.1% BSA to 0.1-1mg/ml.
Reactivity life			6 months
Note			For reserch purpose only
Purity			~97% (SDS-PAGE, HPLC)
Description			Source: Recombinant protein corresponding to human Neurotrophin-4, a noncovalently linked homodimer of two 14kD polypeptide monomers (260aa residues), expressed in E. coli. Molecular Weight: ~28kD (260aa) Applications: Suitable for use in SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Biological Activity Fully biologically active when compared to standard. Determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures was found to be in the range of 20-50ng/ml, corresponding to a specific activity of ＞2x10e4IU/mg. Endotoxin: <1EU/mg (LAL) AA Sequence: GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACV CTLLSRTGRA Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.