Heterogeneous Nuclear Ribonucleoproteins A2/B1, Recombinant, Human, aa1-249, GST-Tag (HNRNPA2B1)
Catalog No : USB-370642
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Heterogeneous Nuclear Ribonucleoproteins A2/B1, Recombinant, Human, aa1-249, GST-Tag (HNRNPA2B1) | ||
|---|---|---|---|
| Catalog No | USB-370642 | ||
| Supplier’s Catalog No | 370642 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 55.8 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Involved with pre-mRNA processing. Forms complexes (ribonucleosomes) with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Source: Recombinant protein corresponding to aa1-249 from human HNRNPA2B1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~55.8kD AA Sequence: MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved