SAMHD1, Recombinant, Mouse, aa395-626, His-Tag (SAM Domain and HD Domain-containing Protein 1)

Catalog No : USB-375198
471.28€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name SAMHD1, Recombinant, Mouse, aa395-626, His-Tag (SAM Domain and HD Domain-containing Protein 1)
Catalog No USB-375198
Supplier’s Catalog No 375198
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 30.6
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Host restriction nuclease that blocks early-stage virus replication in dendritic and other myeloid cells. Likewise, suppresses LINE-1 retrotransposon activity. May function by reducing the cellular dNTP levels to levels too low for retroviral reverse transcription to occur. May play a role in mediating proinflammatory responses to TNF-alpha signaling. Source: Recombinant protein corresponding to aa395-626 from mouse SAMHD1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.6kD AA Sequence: DIMITDAFLKADPYVEITGTAGKKFRISTAIDDMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQPKREKIRKEEYERLPQEVAKAKPEKAPDVELKAEDFIVDVINVDYGMEDKNPIDRVHFYCKSNSKQAVRINKEQVSQLLPEKFAEQLIRVYCKKKDGKSLDAAGKHFVQWCALRDFTKPQDGDIIAPLITPLKWNNKTSSCLQEVSKVKTCLK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.